Free Essay

Unilever

In:

Submitted By Maktoom0001
Words 615
Pages 3
Chemical and Physical Properties 1. Computed Properties Molecular Weight | 111.031949 g/mol | Molecular Formula | C2H2NNaO3 | Hydrogen Bond Donor Count | 1 | Hydrogen Bond Acceptor Count | 3 | Rotatable Bond Count | 1 | Exact Mass | 110.993237 g/mol | Monoisotopic Mass | 110.993237 g/mol | Topological Polar Surface Area | 83.2 A^2 | Heavy Atom Count | 7 | Formal Charge | 0 | Complexity | 90.9 | Isotope Atom Count | 0 | Defined Atom Stereocenter Count | 0 | Undefined Atom Stereocenter Count | 0 | Defined Bond Stereocenter Count | 0 | Undefined Bond Stereocenter Count | 0 | Covalently-Bonded Unit Count | 2 |

BLAST
Home | Contact
SIB BLAST Network Service
If results of this search are reported or published, please mention that the computation was performed at the SIB using the BLAST network service.
The SIB BLAST network service uses a server developed at SIB and the NCBI BLAST+ software.
In case of problems, please read the online BLAST help.
If your question is not covered, please contact us.
.
Query Program: BLASTP | Query: Submission (Length=332 ) | Database: UniProtKB database (release 2015_04 of 01-Apr-2015)
47,301,385 sequences; 15,609,779,889 total letters |

| |

Sequences producing significant alignments
Graphical overview of the alignments:

Top of Form

Send selected sequences to:
Bottom of Form
Top of Form

Include query sequence | Db | Description | Score | E-value | Accession | | UniProtKB/TrEMBL | L-lactate dehydrogenase OS=Pan troglodyt... | 676 | 0.0 | H2Q396 (PANTR) | | UniProtKB/Swiss-Prot | L-lactate dehydrogenase A-like 6A OS=Homo... | 676 | 0.0 | Q6ZMR3 (LDH6A_HUMAN) |
Bottom of Form

Alignments
UniProtKB/Swiss-Prot - Q6ZMR3 (LDH6A_HUMAN) L-lactate dehydrogenase A-like 6A OS=Homo sapiens GN=LDHAL6A PE=2 SV=1
Length=332

Score = 676 bits (1745), Expect = 0.0, Method: Compositional matrix adjust. Identities = 332/332 (100%), Positives = 332/332 (100%), Gaps = 0/332 (0%)

Query 1 MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG 60 MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG
Sbjct 1 MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG 60

Query 61 ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM 120 ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM
Sbjct 61 ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM 120

Query 121 IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI 180 IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI
Sbjct 121 IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI 180

Query 181 HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE 240 HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE
Sbjct 181 HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE 240

Query 241 MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI 300 MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI
Sbjct 241 MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI 300

Query 301 TDLIKVKLTLEEEACLQKSAETLWEIQKELKL 332 TDLIKVKLTLEEEACLQKSAETLWEIQKELKL
Sbjct 301 TDLIKVKLTLEEEACLQKSAETLWEIQKELKL 332

|

NPS@ is the IBCP contribution to PBIL in Lyon, France |

[HOME] [NPS@] [HELP] [REFERENCES] [NEWS] [MPSA] [ANTHEPROT] [Geno3D] [SuMo] [Positions] [PBIL]

Monday, March 9th 2015 : NPS@ is online again (see news).
Monday, March 2nd 2015 : NPS@ is offline after disk array hardware failure (see news).
NPS@ is up and running at new URL https://npsa-prabi.ibcp.fr/

| Job BLASTP (ID: 747af4d5fa2c) is running on NPS@ server (started on 20150426-055934).
Results will be shown below. Please wait and don't go back. |
BLASTP results for : UNK_180200
View BLASTP in: [AnTheProt (PC) , Download...] [HELP]
View graphic in : [MPSA] [AnTheProt]

-------------------------------------------------
Top of Form
First step :
Bottom of Form sequences before EXTRACT [go to EXTRACT]. * with E threshold lesser or equal to * and matching any residue from to of query sequence.
You can also select/unselect sequence by clicking on checkbox below after SELECT and before EXTRACT.

Score E Sequences producing significant alignments: (bits) Value NPSA gnl|unipsp|Q2JJQ1 [Bacteria] L-lactate dehydrogenase [Cyanobacte... 284 9e-94 NPSA gnl|unipsp|Q2JRH2 [Bacteria] L-lactate dehydrogenase [Cyanobacte... >sp|Q6ZMR3|LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens GN=LDHAL6A PE=2 SV=1 MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKG ETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLM IPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGI HSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKVISSGYE MVKMKGYTSWGISLSVADLTESILKNLRRVHPVSTLSKGLYGINEDIFLSVPCILGENGI TDLIKVKLTLEEEACLQKSAETLWEIQKELKL

Name | Ligand | MolDock Score | Rerank Score | HBond | [02] Quercetin | Quercetin | -94.2157 | -84.3838 | -5 | [01] Quercetin | Quercetin | -85.1789 | -80.4578 | -10.5078 | [00] Quercetin | Quercetin | -85.071 | -81.5173 | -7.87118 | [09] Quercetin | Quercetin | -84.1612 | -73.6632 | -9.6243 | [06] Quercetin | Quercetin | -82.5795 | -18.0076 | -2.75621 | [05] Quercetin | Quercetin | -81.7373 | -75.1865 | -3.44233 | [08] Quercetin | Quercetin | -80.588 | -78.2467 | -3.73517 | [07] Quercetin | Quercetin | -80.306 | -77.5314 | -5.62173 | [03] Quercetin | Quercetin | -78.6889 | -74.1617 | -10.0169 | [04] Quercetin | Quercetin | -78.5891 | -41.0955 | -5.39731 |

Similar Documents

Premium Essay

Unilever

...STRATEGIC MANAGEMENT GROUP PROJECT UNILEVER MALAYSIA PREPARED FOR : PREPARED BY : GUNAVATHY A/P NADARAJAN 808473 AHMAD FAISAL BIN ABDULLAH 808465 NORZILA BT MOHD HAIDZIR 805494 JAYAUDIN BIN JAMAUDIN 808481 SUBMISSION DATE : Table of Contents 1. Introduction 2. Company Background 3. Industry Background 4. SWOT Analysis 5. TOWS Matrix 6. Strategies and Recommendation * INTRODUCTION The Unilever brand, establish in customer goods in millions of homes across 150 countries, is a trusted brand in nutrition, hygiene and personal care. During its record, Unilever has been adding verve to the lives of customers, creating products that help people feel good, look good and get more out of life. In Malaysia, the Unilever story began in 1947 with the opening of the first Lever Brothers soap and margarine manufacturing plant in Bangsar. Costing RM 12 million, it was reputed to be the largest factory in the country, with machines that could wrap 124 bars of soap a minute.Manufacturing capabilities expanded as the portfolio of products grew, making Lever Brothers a significant employer of the time. With a presence in Malaysia spanning over 60 years, Lever Brothers, who adopted the global Unilever name in 1994, has played a unique role in bearing witness to the country’s economic, social and political development.  Unilever Malaysia is a private limited company that is 70% owned by Unilever PLC (UK), 23% by Pemodalan Nasional Berhad...

Words: 2611 - Pages: 11

Free Essay

Unilever

...Networks and Innovation of Unilever Company 3 1. Introduction 3 2. Internationalization strategy 3 3. Visualization and interpretation of the parent-subsidiary network 4 3.1 Betweenness Centrality 5 3.1 Density of Network 7 3.3 Degree Centrality 8 4. Analysis of the organization’s Network 8 4.1 Locational aspects 8 4.2 Activity aspects 9 4.3 Size aspects 9 5. Implications for the innovation strategy of Unilever 9 5.1 Meeting consumer needs 10 5.2 Introduction of new products 10 5.3 Sustainable Innovation 11 6. Conclusion 11 References 12 Global Networks and Innovation of Unilever Company 1. Introduction Unilever is one of the best companies with its headquarters in London, UK that focus on the wellbeing and health of people by providing products such as affordable soaps, ice creams, household care products and luxurious shampoos (Weingardt, 2007). Unilever has been recognized as a leading provider of brands such as Omo, Knorr, Lipton, Hellmann’s and other trusted local names such as Suave, Pureit, and Blue band. The company has presence all over the world and increased sales gave accounted to increased turnover that hit €53.3 billion in 2015. There are more than 172,000 workers who work for Unilever, and the company has been selected as number one as the fast-moving consumer goods employer, according to the selection of students in 26 countries (Wolf, 2011). 2. Internationalization strategy Unilever being one of the strongest...

Words: 2565 - Pages: 11

Premium Essay

Unilever

...Our Vision Unilever products touch the lives of people every day – whether that's through feeling great because they've got shiny hair and a brilliant smile, keeping their homes fresh and clean, or by enjoying a great cup of tea, satisfying meal or healthy snack. Unilever products touch the lives of people every day – whether that's through feeling great because they've got shiny hair and a brilliant smile, keeping their homes fresh and clean, or by enjoying a great cup of tea, satisfying meal or healthy snack. A clear direction The four pillars of our vision set out the long term direction for the company – where we want to go and how we are going to get there: * We work to create a better future every day * We help people feel good, look good and get more out of life with brands and services that are good for them and good for others. * We will inspire people to take small everyday actions that can add up to a big difference for the world. * We will develop new ways of doing business that will allow us to double the size of our company while reducing our environmental impact. We've always believed in the power of our brands to improve the quality of people’s lives and in doing the right thing. As our business grows, so do our responsibilities. We recognise that global challenges such as climate change concern us all. Considering the wider impact of our actions is embedded in our values and is a fundamental part of who we are. Purpose & principles Our...

Words: 1606 - Pages: 7

Free Essay

Unilever

...on............... (Unilever)". For collection of data i have investigated the relevant newspapers, information from related institutions. In my study, i have found a lot of information about the forming of Environment for Business & Social Responsibilities. I was provided necessary supports from my university and related authorities. Surely this study will enhance my knowledge and experience and work as an important source of information for future work on this topic. Finally, i would like to request you to accept my paper. Thank you in advance for your assistance and advice in this connection. Sincerely yours, |Name | |Signature | | |Reg. No. | | |Imran Hasan Kibria | | | | |071-12-451 | | (i) Acknowledgement This report has been prepared for Md. Shahnur Islam, Course Instructor, Faculty of business, ASAUB. i would like to thank you sir for guiding me with your superior knowledge, experience and care. I would like to thank all the people whom we interviewed at Unilever Bangladesh, for giving...

Words: 5934 - Pages: 24

Premium Essay

Unilever

...Introduction Unilever is a multi-national corporation, formed of Anglo-Dutch parentage that owns many of the world’s consumer product brands in foods, beverages, cleaning agents and personal care products. Unilever employs nearly 180,000 people and had worldwide revenue of almost €40 billion in 2005. Unilever is a dual-listed company consisting of UnileverNV in Rotterdam, Netherlands and Unilever PLC in London, England. This arrangement is similar to that of Reed Elsevier and that of Royal Dutch Shell prior to their unified structure. Both Unilever companies have the same directors and effectively operate as a single business. The current non-executive Chairman of Unilever N.V. and PLC is Michael Treschow while Patrick Cescau is Group Chief Executive, who will retire at the end of 2008. Mr Paul Polman will succeed Patrick Cescau as Group Chief Executive. The company is widely listed on the world’s stock exchanges. 1.2 Origin of report Since practical orientation is an integral part of the BBA program, I tried to expose real life performance of Uniliver by preparing this  report. To prepare this report I have come across with different information of the Uniliver. From the collected information I understand the company’s activities in the market as Uniliverll as in their internal preparation for marketing and others activities. I expect that this report will fulfill the requirement of BBA program and provide a clear idea about the Uniliver activities and other multi-national...

Words: 19567 - Pages: 79

Free Essay

Unilever

...“Coping strategies Adopted by unilever In Pakistan to Overcome the World wide Economic crisis in International Business.” Letter of Authorization This research report on “Coping strategies adopted by unilever in Pakistan to overcome the world wide economic crisis in International Business.” was assigned by international business analysis course instructor, Sir Arshad Husain. The matter presented for reader in this report is authorized by our course instructor. Letter of transmittal We would like to request to our course instructor Mr. Arshad Husain to kindly accept this report and take into consideration to research work that we have accomplished according to course requirement of preparing a term report on “Coping strategies adopted by unilever in Pakistan to overcome the world wide economic crisis in International Business.” in order to have a better understanding of the practical implications of international business analysis ACKNOWLEDGEMENTS: This report has contributed a major accumulation to our knowledge of the topic. We are Thankful to Allah for making it possible for us, and to our course instructor who supported us throughout this research We are also thankful to the management of Lever Brothers Pakistan Limited, RF, especially Mr. Shahzeb Mehmood who provided useful guidance and information for understanding the practical work of the organization to understand the global presence of Unilever Company. TABLE OF CONTENTS EXECUTIVE SUMMARY CHAPTER...

Words: 11139 - Pages: 45

Free Essay

Unilever

...version of the Unilever Annual Report and Accounts 2007 is an exact copy of the document provided to Unilever’s shareholders. Certain sections of the Unilever Annual Report and Accounts 2007 have been audited. Sections that have been audited are set out on pages 69 to 121, 125 to 126, 128 to 130 and 133 to 135. The auditable part of the report of the Remuneration Committee as set out on page 49 has also been audited. The maintenance and integrity of the Unilever website is the responsibility of the Directors; the work carried out by the auditors does not involve consideration of these matters. Accordingly, the auditors accept no responsibility for any changes that may have occurred to the financial statements since they were initially placed on the website. Legislation in the United Kingdom and the Netherlands governing the preparation and dissemination of financial statements may differ from legislation in other jurisdictions. Disclaimer Except where you are a shareholder, this material is provided for information purposes only and is not, in particular, intended to confer any legal rights on you. This Annual Report and Accounts does not constitute an invitation to invest in Unilever shares. Any decisions you make in reliance on this information are solely your responsibility. The information is given as of the dates specified, is not updated, and any forward-looking statements are made subject to the reservations specified on the final page of the Report. Unilever accepts no responsibility...

Words: 94318 - Pages: 378

Premium Essay

Unilever

...How Unilever’s Brands Connect with Consumers From soap to soup, Unilever markets a wide range of personal care products, foods, and household cleaners under popular brands like Dove, Bertolli, Lipton, Lux, Axe, Sunsilk, Surf, and Omo. Two billion consumers buy its products every day, adding up to annual revenue of $62 billion. The Anglo-Dutch company constantly conducts research to learn more about what consumers want and need, identifying even seemingly small changes that can make a big difference in the daily lives of people worldwide. One of the company’s most memorable marketing initiatives has been Dove’s “Campaign for Real Beauty.” Based on extensive consumer research into women’s attitudes and emotions, the campaign uses ads, YouTube videos, special events, and other communications to counter beauty stereotypes and make the point that real beauty is more than skin deep. By linking its soap brand to messages reinforcing positive self-esteem for women of all ages, races, sizes, and shapes, Dove has won the admiration and loyalty of consumers in many countries. Unilever’s Ragú food brand has been courting parents with Facebook and YouTube communications that encourage ongoing conversations with marketers and among its brand fans. For example, marketers recently used the brand’s Facebook page (which has more than one million “likes”) to start a dialogue about getting children to eat. Its Facebook fans responded with dozens of additional ideas, which Ragú’s...

Words: 699 - Pages: 3

Free Essay

Unilever Report

...unilever SUBMITTED TO: MS.ERAJ GROUP MEMBERS: ERUM FAROOQUI 12 KANWAL TAHIR 21 QURRAT.UL.AIN IRSHAD 75 CONTENT: * Background. * Head Office * Vision. * Mission. * Unilever Key Facts. * Unilever Portfolio. * Product and Service Analysis. * Unilever’s Marketing Strategy. * Unilever’s Operational And Distributional Strategy. com BACK GROUND In the 1890s, William Hesketh Lever, founder of Lever Bros and later Lord Leverhulme, wrote down his ideas for Sunlight Soap – his revolutionary new product that helped popularize cleanliness and hygiene in Victorian England. “It was toward make cleanliness commonplace; to lessen work...

Words: 2163 - Pages: 9

Premium Essay

Unilever Bangladesh

...Investment (FDI). Doing business in Bangladesh is much easier than most of the developing countries. A recent report entitled “Doing Business in 2007: Creating Jobs” published jointly by World Bank and IFC placed Bangladesh in 68th position in terms of easy of doing business among 175 countries (World Bank, 2007). This places Bangladesh ahead of other countries in the region such as India (88th) and China (128th). In 2005 total FDI inflow into Bangladesh increased by 84% amounting to US$845 million. This growth is the second highest in the entire South Asia region. According to the World Investment Report 2006, Bangladesh is now ahead of India in terms of the FDI Performance Index being ranked 116 among 200 economies (BOI Handbook, 2007). Unilever is an Anglo-Dutch company, with...

Words: 21445 - Pages: 86

Free Essay

Unilever Merger

...Global Business History - Essay tutorial 2 Name: Cas Klatte Student number: S2535963 Date: 27/11/2014 Unilever merger: Expansion & Efficiency Introduction In the article “Purposive Strategy or Serendipity? Development and Diversification in Three Consumer Product Companies, 1918-39: J. & J. Colman, Reckitt & Sons, and Lever Bros”, Roy Church and Christine Clark discuss, amongst other cases, the merger between Lever Brothers and the Dutch Margarine Union into Unilever. Unilever is still considered as a key player in the household industry. Church and Clark provide a seemingly complete overview on this strong merger, but they undervalue two main aspects: what exactly made the merger ‘Unilever’ possible and in what way did the merger influence the value chain and organizational structure of the company? Reasons for the merger The main arguments for the merger can be attributed to Lever’s production technology and improved value chain. When considering production technology, Lever tried to alter the balance of existing products by using a mixture of corporate acquisitions, the development of products in the company’s laboratories or through modification and improvements in the presentation of existing products. This process was called ‘diversification under distress’, and required limited changes in resources. The merger with the Margarine Union was necessary, to make Lever’s margarine more comparable to butter. Furthermore, Lever had to defend its market...

Words: 495 - Pages: 2

Free Essay

Advertising Unilever

...HISTORY oF UNILEVER William Hesketh Lever, founder of Lever Bros, an Anglo-Dutch Company which was formed in the year 1930 by the merger of British soap maker “Lever Brothers” and Dutch Margarine producer “Margarine Union”. The merger unit formed two separate entities known as Unilever Plc in London and Unilever NV in Rotterdam, The Netherlands. 4. DOVE In 1940, Formula for Dove Soap Bar. World War II -Recognized as a mild soap. In 1970s, Dove popularity Increased. In 1990s, it was a success in the market, despite being priced at 50% premium over other body wash brands. In 1995, extension of personal care products. 5. By 1999 sales reached around US$1 billion and the brand was growing at 20% per annum. In early 2000s, women were not buying the brand in more than one or two categories. Need for Brand Positioning without loosing customer base. Dove was getting strong competition from other brands. In 2005 ,Dove was the world’s largest cleansing brand with annual sales of 2.5 billion Euros in more than 80 countries. 6. CAMPAIGN FOR REAL BEAUTY In June 2005, Unilever launched an ad campaign in US for its dove intensive firming range. The main purpose of the campaign was to challenge the stereotypes set by the beauty industry over the years. Campaign’s main aim was to promote its dove range of personal care products globally. Beauty advertisers bombarded consumers with idealized images of models, supermodels and celebrities which hurt consumers self-esteem. 7. Unilever featured...

Words: 1978 - Pages: 8

Free Essay

Tea Unilever

...Samir Lakhani Stephen Martinek Mahek Parikh Unilever Group Submission Unilever is a consumer goods company that has a variety of product types to serve consumers across the globe. For this case, Unilever’s tea brand, Lipton, is focused on sustainability for the production of their tea production. Sustainability is defined as a method of using a resource so that the resource is not depleted or permanently damaged. In other words, it is focusing on a production method that is sustainable long-term. Currently, Unilever has about 25% of their tea from Rainforest Alliance Certified farms, which brought forward gains in the environmental, social, and economic sustainability of tea production. It was one of the few brands of tea that was able to have ethical practices while growing beyond a niche market into a larger market share. However, Unilever is looking to source 100% of its agricultural raw materials sustainably (Rainforest Alliance certified) by the year of 2020. This is a lofty and ambitious goal that requires a supply chain transformation, as nearly 8 million tons of commodities across 50 different crops are required for production. There are multiple reasons for this action: to have ethical production practices, to make their brand favorable to customers, and to increase the longevity of their farms. However, they will bear costs of having to increase the market price and convincing their suppliers to be certified. For example, the firm...

Words: 2305 - Pages: 10

Free Essay

Unilever Bangladesh

...EXECUTIVE SUMMARY Unilever is an Anglo-Dutch company, with a history of grand operation, Today it owns most of the world's consumer product brands in food, beverages, cleaning agents and personal care products. Unilever Bangladesh Ltd is one of the world’s most successful consumer goods manufacturing companies with local manufacturing facilities. Unilever brands are trusted everywhere and, by listening to the people who buy them, they've grown into one of the world's most successful consumer goods companies. In fact, 150 million times a day, in over 190 countries, someone somewhere chooses a Unilever product. Unilever Bangladesh Limited has five departments to carry out all their organizational functions. This report is designed in six chapters. Initially the opening words about the report were described in the first segment titled “Introduction”. The next segment “Overview of Unilever” contains the history of Unilever, Unilever Bangladesh Ltd, and Organizational structure. The next chapters are on firm organizing, Industry Analysis, CSR Activities, Innovative Managerial Practices And at last is the conclusion of this report Table of Contents Contents | page | 1. Introduction…………… | | 1.1. Unilever Global | 1 | 1.2. History of Unilever | 1-2 | 1.3. Unilever Bangladesh Limited | 2 | 1.4. Unilever Today | 2-3 | 1.5. Mission | 3 | 1.6. Vision | 3 | 1.7. Strategies followed by Unilever | 3-5 | 1.8. Consumers | 5-6 | 1.9. Products offered | 7-9 | | | 2. Firm...

Words: 4112 - Pages: 17

Free Essay

About Unilever

...Unilever is a British-Dutch multinational consumer goods company co-headquartered in Rotterdam, Netherlands, and London, United Kingdom. Its products include food, beverages, cleaning agents and personal care products. It is the world's third-largest consumer goods company measured by 2012 revenue, after Procter & Gamble and Nestlé.[5] Unilever is the world's largest producer of food spreads, such as margarine.[6] One of the oldest multinational companies, its products are available in around 190 countries.[7] Unilever owns over 400 brands, but focuses on 14 brands with sales of over 1 billion euros - Axe/Lynx, Dove, Omo, Becel/Flora, Heartbrand ice creams, Hellmann's, Knorr, Lipton, Lux, Magnum, Rama, Rexona, Sunsilk and Surf.[7] It is a dual-listed company consisting of Unilever N.V., based in Rotterdam, and Unilever plc, based in London. The two companies operate as a single business, with a common board of directors. Unilever is organised into four main divisions - Foods, Refreshment (beverages and ice cream), Home Care, and Personal Care. It has research and development facilities in the United Kingdom (2), the Netherlands, China, India and the United States.[8] Head office Unilever N.V. Rotterdam, Netherlands Unilever was founded in 1930 by the merger of the Dutch margarine producer Margarine Unie and the British soapmaker Lever Brothers. During the second half of the 20th century the company increasingly diversified from being a maker of products made of oils and fats...

Words: 343 - Pages: 2